PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK01612.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family GRAS
Protein Properties Length: 824aa    MW: 93943.9 Da    PI: 6.0737
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK01612.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS3596.9e-1103367052374
       GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaNqa 101
                ++lL++cA+av+s d++ a++lL+++++++sp+gd  qRla yf++AL+ rl++ ++  y+ l ++ +s     + l+a++++  ++P+ ++s++ aN++
  PK01612.1 336 TSLLTQCAQAVASYDQRTATQLLKQIKDHSSPHGDESQRLAYYFANALEVRLSG-GTPSYNHLGSNGAS---AYDLLKAYQVYITACPFKRMSQIYANRT 431
                579***************************************************.66667777666666...89************************** PP

       GRAS 102 IleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkpg 199
                Il+  e+++r+HiiDf++ +G+QWp+L+q L++Rp+gpp+lR Tg++ p++g   +e++ +tg+rLa+++e+++vpfe n+ +a+++e++++e+L+++++
  PK01612.1 432 ILKLSEKANRLHIIDFGVLYGFQWPCLIQRLSERPGGPPMLRFTGIEFPQTGfrPSERVIQTGRRLANYCERFKVPFECNM-IAQKWETVKIEDLKLDRN 530
                ***************************************************9*****************************.7***************** PP

       GRAS 200 EalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvva 299
                E ++Vn+  ++++l+de+v  + +rdevL+l+++++P+++++   + +hn++ Fl+rf eal ++salfd++ea+lpre+++r + E+e++gr+++nvva
  PK01612.1 531 ELTVVNCLDRMKNLPDETVIEDCPRDEVLRLIRRINPTLFIHGVLNGNHNAPFFLTRFREALFHFSALFDMFEASLPREDQHRLMFEQEVFGRDVMNVVA 630
                *****************999999***************************************************************************** PP

       GRAS 300 cegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                 eg +r+er et+++W+ r  +aGF++v l+ + +k ++ +++k++ + + v+e+  ++++gWk+r   ++S+W+
  PK01612.1 631 GEGIKRVERPETYKQWQVRNLRAGFRQVGLDGELVKLVRNMVKKHYHRDFVVDEDGMWMLQGWKGRIFQAMSFWQ 705
                **********************************************999*************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098563.61309685IPR005202Transcription factor GRAS
PfamPF035142.4E-107336705IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 824 aa     Download sequence    Send to blast
MDTLFEDLHG SMNNNFRFEH DHHNLDHGFY KGNREFIDPV SPPTNSDLQG EPSPSSGSGS  60
SSEGDSVESS EFSNAIILRF INEVLMDEQE DLEKKPCMLH DCLALQTAEK SFYDVIGEEY  120
PSPLPCLDRN FDVPNDQYVQ SFSTDSSIES ITATSLSNLD VAESNWAWNQ DEVGPFTVQN  180
SIIESPEDTL LTPDSSWHLG GKAVAQGKSG FFLPTKLNGT AFAIQEKNQS HSTTVNGSEG  240
KKGHHRHREF GSDSPEEEEE EGRRTKHTAV YPDFSEPTEI FDEVLLCPKP TLHDKESCGL  300
DEKEDNKPRQ QRKKQQQTKR TKQKKRNSNH GLVDFTSLLT QCAQAVASYD QRTATQLLKQ  360
IKDHSSPHGD ESQRLAYYFA NALEVRLSGG TPSYNHLGSN GASAYDLLKA YQVYITACPF  420
KRMSQIYANR TILKLSEKAN RLHIIDFGVL YGFQWPCLIQ RLSERPGGPP MLRFTGIEFP  480
QTGFRPSERV IQTGRRLANY CERFKVPFEC NMIAQKWETV KIEDLKLDRN ELTVVNCLDR  540
MKNLPDETVI EDCPRDEVLR LIRRINPTLF IHGVLNGNHN APFFLTRFRE ALFHFSALFD  600
MFEASLPRED QHRLMFEQEV FGRDVMNVVA GEGIKRVERP ETYKQWQVRN LRAGFRQVGL  660
DGELVKLVRN MVKKHYHRDF VVDEDGMWML QGWKGRIFQA MSFWQPAXIF RASIAVLRST  720
YYVAFGNECM PQHYTLAXAT GLRIPGILQV INQLMFSSGT DXLEMDPQPQ NNFGNTSVDH  780
NHFAHLAGPF FDAGDLRIFV DAAIHCISPF RISMQIQCIF TAWG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-403397058375GRAS family transcription factor containing p
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1316324QTKRTKQKK
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007211325.10.0hypothetical protein PRUPE_ppa002166mg
TrEMBLM5WFN10.0M5WFN1_PRUPE; Uncharacterized protein
STRINGPOPTR_0009s03850.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13134339
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G29060.11e-171GRAS family protein